Service hotline:+86-(0)-18115476705
Product details
Cat#:206P01
Three Letter Code: H-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH₂
One Letter Code: TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH₂
Synonyms: SCP (human)
Molecular Formula: C₁₉₅H₃₂₆N₅₆O₅₃S₂
Relative Molecular Mass: 4367.21
CAS#: 352020-03-2
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Details: Stresscopin is a specific ligand for the corticotropin-releasing hormone receptor type 2 (CRHR2). Transcripts are expressed in brain and most tissues analyzed. Intraperitoneal injections of stresscopin suppresses heat-induced edema formation in anesthetized rats. It also decreases food intake and exhibits an inhibitory effect on gastric emptying activity. This CRHR2 agonist might represent an endogenous ligand for maintaining homeostasis after stress.
1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.