Service hotline:+86-(0)-18115476705
Product details
Cat#: 125P02
Three Letter Code: H-Phe-Pro-Met-Phe-Lys-Arg-Gly-Arg-Cys-Leu-Cys-Ile-Gly-Pro-Gly-Val-Lys-Ala-Val-Lys-Val-Ala-Asp-Ile-Glu-Lys-Ala-Ser-Ile-Met-Tyr-Pro-Ser-Asn-Asn-Cys-Asp-Lys-Ile-Glu-Val-Ile-Ile-Thr-Leu-Lys-Glu-Asn-Lys-Gly-Gln-Arg-Cys-Leu-Asn-Pro-Lys-Ser-Lys-Gln-Ala-Arg-Leu-Ile-Ile-Lys-Lys-Val-Glu-Arg-Lys-Asn-Phe-OH (Disulfide bonds between Cys⁹ and Cys³⁶/Cys¹¹ and Cys⁵³)
One Letter Code: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Synonyms: I-TAC (human), CXCL11 (human)
Molecular Formula: C₃₆₈H₆₁₉N₁₀₇O₉₈S₆
Relative Molecular Mass: 8303.02
CAS#: 1927911-33-8
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Cytokines/Chemokines & their Receptors|
Regenerative Medicine
Details: Synthetically produced; cysteines are oxidized. Contains BSA
(low levels of endotoxins) in a ratio of 1:50. The chemokine
I-TAC (interferon-inducible T cell α-chemoattractant), a
non-ELR C-X-C chemokine, is regulated by interferon and has
potent chemoattractant activity for interleukin-2-activated T
cells, but not for freshly isolated unstimulated T cells,
neutrophils, or monocytes. It has been suggested that I-TAC
constitutes a major chemoattractant for effector T cells,
involved in the pathophysiology of neuroinflammatory
disorders, although it may play a role in the migration of activated T cells during interferon-dominated immune response.
1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.