Service hotline：+86-(0)-18115476705
Product details
Cat#: 125P08
Three Letter Code: H-Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Lys-OH trifluoroacetate salt(Disulfide bonds between Cys⁹ and Cys³⁴/Cys¹¹ and Cys⁵⁰)
One Letter Code: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Synonyms: Stromal Cell-Derived Factor-1α (human)
Molecular Formula: C₃₅₆H₅₇₈N₁₀₆O₉₃S₄
Relative Molecular Mass: 7959.43
CAS#: 1268129-65-2
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Cancer Research|
Cell Culture|
Cytokines/Chemokines & their Receptors|
Infectious Disease|
Regenerative Medicine
Details: Synthetically produced, contains BSA (low levels of
endotoxins) in a ratio of 1:50.
Multifunctional cytokine that signals through CXCR4. SDF-1α
is involved in several pathological conditions such as
rheumatoid arthritis, pulmonary fibrosis, metastasis and
leukemia cell progression.
SDF-1α-dependent internalization of the CXCR4 HIV coreceptor
contributes to inhibition of HIV replication
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
