Service hotline:+86-(0)-18115476705

Product details
Cat#:141P12
Three Letter Code: H-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂ trifluoroacetate salt
One Letter Code: GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Synonyms: (Glu⁹)-Exendin-4 (2-39), (Des-His¹,Glu⁹)-Exenatide, (Des-His¹,Glu⁹)-Exendin-4
Molecular Formula: C₁₇₉H₂₇₇N₄₇O₅₉S
Relative Molecular Mass: 4063.52
CAS#: 196109-34-9
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Diabetes
Details: Exendin-4 analog, effective GLP-1 antagonist.

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.