Service hotline：+86-(0)-18115476705
Product details
Cat#：141P13
Three Letter Code: H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH₂ trifluoroacetate salt
One Letter Code: HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH₂
Molecular Formula: C₁₈₄H₂₈₂N₅₀O₆₁S
Relative Molecular Mass: 4202.63
CAS#: 130357-25-4
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Diabetes
Details: Exendin-3, a member of the glucagon superfamily, was originally isolated from the venom of the lizard, Heloderma horridum. At low concentrations, the 39-amino acid peptide interacts with putative exendin receptors causing an increase in pancreatic acinar cAMP, whereas at higher concentrations it interacts with VIP receptors to stimulate an increase in cellular cAMP and amylase release.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
