Service hotline:+86-(0)-18115476705
Product details
Cat#:141P17
Three Letter Code: H-His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-NH₂
One Letter Code: HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH₂
Molecular Formula: C₁₇₆H₂₈₅N₄₇O₄₉
Relative Molecular Mass: 3843.49
CAS#: 89468-62-2
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Details: Helodermin (exendin-2) was originally isolated from the venom of Gila monster (Heloderma suspectum). A high degree of sequence similarities to secretin, VIP, PHI, and GRF from mammal and bird was observed over the entire N-terminal (1-27) sequence. The isolation of helodermin was the first demonstration of the existence of a secretin/VIP-related peptide in an animal that is neither mammal nor bird. Among all known VIP-related peptides, helodermin was the most potent in stimulating cAMP production by NCI-H345 cell line.
1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.