Service hotline:+86-(0)-18115476705

Product details
Cat#:141P18
Three Letter Code: H-His-Ser-Asp-Ala-Ile-Phe-Thr-Glu-Glu-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-NH₂
One Letter Code: HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP-NH₂
Molecular Formula: C₁₇₆H₂₈₃N₄₅O₅₁
Relative Molecular Mass: 3845.46
CAS#: 209340-47-6
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Details: (Glu⁸·⁹)-Helodermin has been isolated from the salivary gland of the Gila monster Heloderma suspectum. It consists of 35 amino acids and shares 53 and 42% homology with human pituitary adenylate cyclase activating polypeptide (PACAP) and vasoactive intestinal peptide (VIP), respectively. It was shown to have high affinity for the mammalian VIP₂ receptor and equal potency and efficacy for stimulating cAMP production compared with mammalian VIP and PACAP. Even a helodermin-preferring receptor has been described. Furthermore, immunohistochemical studies, using antibodies that did not cross-react with mammalian VIP or PACAP or other known members of the GLP-1 / VIP / PACAP peptide family suggested the existence of a mammalian homologue to (Glu⁸·⁹)-Helodermin distinct from VIP and PACAP.

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.