Service hotline：+86-(0)-18115476705
Product details
Cat#：145P07
Three Letter Code: H-Ser-Leu-Asn-Phe-Glu-Glu-Leu-Lys-Asp-Trp-Gly-Pro-Lys-Asn-Val-Ile-Lys-Met-Ser-Thr-Pro-Ala-Val-Asn-Lys-Met-Pro-His-Ser-Phe-Ala-Asn-Leu-Pro-Leu-Arg-Phe-NH₂ trifluoroacetate salt
One Letter Code: SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF-NH₂
Synonyms: S-37-F-NH₂, NPSF
Molecular Formula: C₁₉₅H₃₀₄N₅₂O₅₁S₂
Relative Molecular Mass: 4257.01
CAS#: 381006-66-2
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Details: Neuropeptide NPSF is, as the octapeptide NPVF, a partial sequence of the human FMRF amide-related peptides precursor protein. The NPFF-related peptide caused a 50 % reduction in the antinociceptive effects of morphine.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
