Service hotline：+86-(0)-18115476705
Product details
Cat#：146P17
Three Letter Code: H-Ala-Pro-Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Pro-Gln-Met-Gly-Asp-Gln-Asp-Gly-Lys-Arg-Glu-Thr-Ala-Leu-Glu-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-His-Pro-Pro-Gln-Pro-Ser-OH trifluoroacetate salt
One Letter Code: APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS
Synonyms: GALP (human)
Molecular Formula: C₂₉₂H₄₅₁N₈₃O₈₄S
Relative Molecular Mass: 6500.37
CAS#: 245114-99-2
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Obesity Research
Details: Galanin-like peptide (GALP) is a 60 amino acid
neuropeptide first isolated from the porcine hypothalamus
and subsequently also identified in rats and humans.
GALP exhibits a higher affinity (~18-fold) for the GALR2
receptor compared to the GALR1 receptor, whereas
galanin is relatively non-selective. Investigations of the
physiological role of GALP revealed that GALP induces
food intake with a ten times higher orexigenic activity than galanin. Furthermore, GALP could affect the emotional state in the CNS. Therefore, GALP represents
an orexigenic and anxiogenic peptide.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
