Cat#：146P18
Three Letter Code: H-Ala-Pro-Val-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Pro-Pro-Ser-Arg-Ala-Glu-Gly-Gly-Gly-Lys-Gly-Lys-Thr-Ala-Leu-Gly-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Pro-Gln-Ser-Gln-Leu-Ala-Ser-OH trifluoroacetate salt
One Letter Code: APVHRGRGGWTLNSAGYLLGPVLHPPSRAEGGGKGKTALGILDLWKAIDGLPYPQSQLAS
Synonyms: GALP (porcine)
Molecular Formula: C₂₈₁H₄₄₃N₈₁O₇₈
Relative Molecular Mass: 6204.11
CAS#: 245114-96-9
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Details: This member of the galanin family has been isolated from porcine hypothalamus. It is a 60 amino acid peptide that, unlike galanin, has a non-amidated C-terminus. GALP amino acid residues (9-21) are identical to the biologically active N-terminal (1-13) portion of galanin. Receptor binding studies revealed that GALP had a high affinity for the galanin receptor 2 (GALR2; IC₅₀ = 0.24 nM) and a lower affinity for the GALR1 receptor (IC₅₀ = 4.3 nM). GALP is therefore an endogenous ligand that preferentially binds the GALR2 receptor, whereas galanin is relatively non-selective.