Service hotline:+86-(0)-18115476705
Product details
Cat#:146P18
Three Letter Code: H-Ala-Pro-Val-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Pro-Pro-Ser-Arg-Ala-Glu-Gly-Gly-Gly-Lys-Gly-Lys-Thr-Ala-Leu-Gly-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Pro-Gln-Ser-Gln-Leu-Ala-Ser-OH trifluoroacetate salt
One Letter Code: APVHRGRGGWTLNSAGYLLGPVLHPPSRAEGGGKGKTALGILDLWKAIDGLPYPQSQLAS
Synonyms: GALP (porcine)
Molecular Formula: C₂₈₁H₄₄₃N₈₁O₇₈
Relative Molecular Mass: 6204.11
CAS#: 245114-96-9
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Details: This member of the galanin family has been isolated from
porcine hypothalamus. It is a 60 amino acid peptide that,
unlike galanin, has a non-amidated C-terminus. GALP
amino acid residues (9-21) are identical to the biologically
active N-terminal (1-13) portion of galanin. Receptor
binding studies revealed that GALP had a high affinity for
the galanin receptor 2 (GALR2; IC₅₀ = 0.24 nM) and a lower
affinity for the GALR1 receptor (IC₅₀ = 4.3 nM). GALP is
therefore an endogenous ligand that preferentially binds
the GALR2 receptor, whereas galanin is relatively
non-selective.
1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.