Cat#：146P19
Three Letter Code: H-Ala-Pro-Ala-His-Arg-Gly-Arg-Gly-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Val-Leu-His-Leu-Ser-Ser-Lys-Ala-Asn-Gln-Gly-Arg-Lys-Thr-Asp-Ser-Ala-Leu-Glu-Ile-Leu-Asp-Leu-Trp-Lys-Ala-Ile-Asp-Gly-Leu-Pro-Tyr-Ser-Arg-Ser-Pro-Arg-Met-Thr-OH trifluoroacetate salt
One Letter Code: APAHRGRGGWTLNSAGYLLGPVLHLSSKANQGRKTDSALEILDLWKAIDGLPYSRSPRMT
Synonyms: GALP (rat)
Molecular Formula: C₂₈₈H₄₆₁N₈₇O₈₃S
Relative Molecular Mass: 6502.43
CAS#: 245114-97-0
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Obesity Research
Details: Galanin-like peptide (GALP), first isolated from the porcine hypothalamus and subsequently also identified in rats and humans, is a 60 amino acid neuropeptide that unlike galanin, has a non-amidated C-terminus. Its amino acid residues (9-21) are identical to the biologically active N-terminal (1-13) fragment of galanin. In contrast to galanin which is relatively non-selective, receptor binding studies revealed that GALP had a high affinity for the galanin receptor 2 (GALR2) and a lower affinity for the GALR1 receptor. Furthermore, it could be demonstrated that GALP stimulates food intake with a ten fold higher orexigenic activity than galanin and may also affect emotional state in the CNS.