Service hotline:+86-(0)-18115476705
/Gastric Inhibitory Polypeptide and Fragments (7)
/Gastric Inhibitory Polypeptide (porcine) trifluoroacetate salt
Product details
Cat#:147P04
Three Letter Code: H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH trifluoroacetate salt
One Letter Code: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ
Synonyms: GIP (porcine), Glucose-Dependent Insulinotropic Polypeptide (porcine), Gastric Inhibitory Peptide, porcine
Molecular Formula: C₂₂₅H₃₄₂N₆₀O₆₆S
Relative Molecular Mass: 4975.62
CAS#: 11063-17-5
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Diabetes
1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.