Service hotline：+86-(0)-18115476705
/Gastric Inhibitory Polypeptide and Fragments (7)
/Gastric Inhibitory Polypeptide (1-30) amide (porcine) trifluoroacetate salt
Product details
Cat#：147P05
Three Letter Code: H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-NH₂ trifluoroacetate salt
One Letter Code: YAEGTFISDYSIAMDKIRQQDFVNWLLAQK-NH₂
Synonyms: GIP (1-30) amide (porcine), Glucose-Dependent Insulinotropic Polypeptide (1-30) amide (porcine), Gastric Inhibitory Peptide (1-30), amide, porcine
Molecular Formula: C₁₆₂H₂₄₅N₄₁O₄₇S
Relative Molecular Mass: 3551.04
CAS#: 134846-93-8
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Diabetes
Details: This GIP fragment has potent insulinotropic activity in the isolated, perfused rat pancreas but greatly reduced somatostatinotropic activity in the isolated perfused rat stomach. The site responsible for insulinotropic activity apparently lies between residues 19 and 30 of GIP.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
