Service hotline：+86-(0)-18115476705
Product details
Cat#：153P25
Three Letter Code: H-Arg-Ser-Leu-Gln-Asp-Thr-Glu-Glu-Lys-Ser-Arg-Ser-Phe-Ser-Ala-Ser-Gln-Ala-Asp-Pro-Leu-Ser-Asp-Pro-Asp-Gln-Met-Asn-Glu-Asp-OH trifluoroacetate salt
One Letter Code: RSLQDTEEKSRSFSASQADPLSDPDQMNED
Synonyms: Glicentin-Related Polypeptide (human), Preproglucagon (21-50) (human), Proglucagon (1-30) (human)
Molecular Formula: C₁₃₆H₂₁₅N₄₁O₅₈S
Relative Molecular Mass: 3384.51
CAS#: 1132745-52-8
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Diabetes
Details: GRPP (human) also known as glicentin-related polypeptide (human) is a synthetic analog of a cleavage product resulting from proglucagon processing in pancreatic α- and intestinal L-cells.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
