Welcome to TGpeptide-Professional peptide manufacturer.

Service hotline:+86-(0)-18115476705

153P26

Oxyntomodulin (bovine, dog, porcine) trifluoroacetate salt

H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH trifluoroacetate salt

Purity: >95%HPLC
Storage Conditions: -20 ± 5 °C

We can provide this product with other purity from crude to 98%, please contact us for more information.
For reserach use only and not for human use!


Product details

Cat#:153P26
Three Letter Code: H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH trifluoroacetate salt
One Letter Code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Synonyms: Glucagon-37 (bovine, dog, porcine), OXM (bovine, dog, porcine), Preproglucagon (53-89) (bovine, dog, porcine), Proglucagon (33-69) (bovine, dog, porcine)
Molecular Formula: C₁₉₂H₂₉₅N₅₉O₆₀S
Relative Molecular Mass: 4421.88
CAS#: 74870-06-7
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Diabetes| Veterinary Medicine
Details: Oxyntomodulin is released from the gut postprandially, in proportion to energy intake. Circulating levels of oxyntomodulin are elevated in several conditions associated with anorexia. Central injection of oxyntomodulin reduces food intake and weight gain in rodents, suggesting that oxyntomodulin signals food ingestion to hypothalamic appetite-regulating circuits.


How to place a order:

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.

Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.