Service hotline:+86-(0)-18115476705

Product details
Cat#:167P04
Three Letter Code: H-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH₂ trifluoroacetate salt
One Letter Code: IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH₂
Synonyms: Malignant Melanoma Metastasis-Suppressor KiSS-1 (94-121) (human), KiSS-1 (94-121) (human), Metastin (27-54) (human)
Molecular Formula: C₁₄₉H₂₂₆N₄₂O₃₉
Relative Molecular Mass: 3229.69
CAS#: 1135442-77-1
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Cancer Research
Details: An LRF-amide motif containing fragment of malignant melanoma metastasis-suppressor KiSS-1 which binds to human GPR54, a G-protein-coupled receptor also known as AXOR12. It shows lower agonistic potency towards AXOR12 than malignant melanoma metastasis-suppressor Kisspeptin-10.

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.