Service hotline：+86-(0)-18115476705
Product details
Cat#：177P29
Three Letter Code: H-Glu-Val-Lys-Tyr-Asp-Pro-Cys-Phe-Gly-His-Lys-Ile-Asp-Arg-Ile-Asn-His-Val-Ser-Asn-Leu-Gly-Cys-Pro-Ser-Leu-Arg-Asp-Pro-Arg-Pro-Asn-Ala-Pro-Ser-Thr-Ser-Ala-OH (Disulfide bond)
One Letter Code: EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA
Synonyms: DNP
Molecular Formula: C₁₈₀H₂₈₂N₅₆O₅₆S₂
Relative Molecular Mass: 4190.69
CAS#: 255721-52-9
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Cardiovascular System & Diseases
Details: The 38 amino acid peptide DNP, which has been originally isolated from the venom of the green mamba snake (Dendroaspis angusticeps), shares structural homology with the family of natriuretic peptides. DNP contains a 17 amino acid disulfide ring similar to ANP, BNP, and CNP, which mediate biological actions through particulate guanylyl cyclase receptors and generation of guanosine monophosphate (cGMP).
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
