Service hotline:+86-(0)-18115476705
Product details
Cat#:177P30
Three Letter Code: H-Asn-Pro-Met-Tyr-Asn-Ala-Val-Ser-Asn-Ala-Asp-Leu-Met-Asp-Phe-Lys-Asn-Leu-Leu-Asp-His-Leu-Glu-Glu-Lys-Met-Pro-Leu-Glu-Asp-OH
One Letter Code: NPMYNAVSNADLMDFKNLLDHLEEKMPLED
Synonyms: Prepro-hANF (26-55) Cardiodilatin-Related Peptide (human), NT-pro-ANP (human) (1-30), Prepro-ANF (26-55), human
Molecular Formula: C₁₅₂H₂₃₆N₃₈O₅₁S₃
Relative Molecular Mass: 3507.97
CAS#: 112160-82-4
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Cardiovascular System & Diseases
Details: Prepro-atrial natriuretic factor (26-55) (human) (NT-pro-ANP (1-30)) is one of four peptide hormones derived from the atrial natriuretic prohormone. It is also known as long acting natriuretic peptide. The peptide has potent vasodilatory properties equal to atrial natriuretic factor. Vasodilation is associated with a 4-5 fold increase in cyclic GMP levels due to activation of particulate guanylate cyclase activity. Like prepro-atrial natriuretic factor (56-92) and kaliuretic peptide it is present in higher concentration in individuals with congestive heart failure. It causes the maximal increase in prostaglandin E2 (PGE2) levels of the three peptides. The known increase in PGE2 in chronic heart failure may be in part secondary to these peptides.
1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.