Welcome to TGpeptide-Professional peptide manufacturer.

Service hotline:+86-(0)-18115476705

178P05

Nesfatin-1 (rat) trifluoroacetate salt

H-Val-Pro-Ile-Asp-Val-Asp-Lys-Thr-Lys-Val-His-Asn-Val-Glu- Pro-Val-Glu-Ser-Ala-Arg-Ile-Glu-Pro-Pro-Asp-Thr-Gly-Leu-Tyr -Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr- Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu- Glu-Ile-Arg-Ser-Gly-Arg-Leu-Ser-Gln-Glu-Leu-Asp-Leu-Val- Ser-His-Lys-Val-Arg-Thr-Arg-Leu-Asp-Glu-Leu-OH trifluoroacetate salt

Purity: >95%HPLC
Storage Conditions: -20 ± 5 °C

We can provide this product with other purity from crude to 98%, please contact us for more information.
For reserach use only and not for human use!


Product details

Cat#:178P05
Three Letter Code: H-Val-Pro-Ile-Asp-Val-Asp-Lys-Thr-Lys-Val-His-Asn-Val-Glu-Pro-Val-Glu-Ser-Ala-Arg-Ile-Glu-Pro-Pro-Asp-Thr-Gly-Leu-Tyr-Tyr-Asp-Glu-Tyr-Leu-Lys-Gln-Val-Ile-Glu-Val-Leu-Glu-Thr-Asp-Pro-His-Phe-Arg-Glu-Lys-Leu-Gln-Lys-Ala-Asp-Ile-Glu-Glu-Ile-Arg-Ser-Gly-Arg-Leu-Ser-Gln-Glu-Leu-Asp-Leu-Val-Ser-His-Lys-Val-Arg-Thr-Arg-Leu-Asp-Glu-Leu-OH trifluoroacetate salt
One Letter Code: VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGRLSQELDLVSHKVRTRLDEL
Synonyms: Nucleobindin-2 (1-82) (rat), NUCB2 (1-82) (rat), DNA-Binding Protein NEFA (1-82) (rat)
Molecular Formula: C₄₂₄H₆₈₄N₁₁₆O₁₃₆
Relative Molecular Mass: 9582.8
CAS#: 917528-37-1
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Obesity Research| Pituitary & Hypothalamic Hormones


How to place a order:

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.

Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.