Service hotline：+86-(0)-18115476705
Product details
Cat#：179P21
Three Letter Code: H-Phe-Leu-Phe-His-Tyr-Ser-Arg-Thr-Gln-Glu-Ala-Thr-His-Pro-Val-Lys-Thr-Gly-Phe-Pro-Pro-Val-His-Pro-Leu-Met-His-Leu-Ala-Ala-Lys-Leu-Ala-Asn-OH trifluoroacetate salt
One Letter Code: FLFHYSRTQEATHPVKTGFPPVHPLMHLAAKLAN
Synonyms: Prepro-NMS (70-103) (human)
Molecular Formula: C₁₈₀H₂₇₁N₄₉O₄₄S
Relative Molecular Mass: 3857.5
CAS#: 894454-10-5
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Pituitary & Hypothalamic Hormones
Details: Preliminary experiments show potent prolactin-releasing activity in rats.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
