Service hotline：+86-(0)-18115476705
Product details
Cat#：182P45
Three Letter Code: H-Asp-Ser-Leu-Leu-Ala-Val-Arg-Trp-Phe-Phe-Ala-Pro-Asp-Gly-Ser-Gln-Glu-Ala-Leu-Met-Val-Lys-Met-Thr-Lys-Leu-Arg-Val-Ile-Gln-Tyr-Tyr-Gly-Asn-Phe-Ser-Arg-Ile-Ala-Asn-Gln-Gln-Arg-Leu-Arg-Leu-Leu-Glu-Glu-OH trifluoroacetate salt
One Letter Code: DSLLAVRWFFAPDGSQEALMVKMTKLRVIQYYGNFSRIANQQRLRLLEE
Molecular Formula: C₂₆₂H₄₁₅N₇₃O₇₂S₂
Relative Molecular Mass: 5803.76
CAS#: 1872441-58-1
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Ion Channel Modulating Agents
Details: Peptide Lv has been discovered via a computational
bioinformatics-based screening process. The neuropeptide
is expressed in retinal photoreceptor layer, hippocampus,
olfactory bulb, cerebellum, cerebral cortex, lung, spleen,
liver and intestine. Peptide Lv enhances L-type
voltage-gated calcium channel (L-VGCC) currents in
retinal photoreceptors.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
