Cat#：182P47
Three Letter Code: H-Ala-Val-Ile-Thr-Gly-Ala-Cys-Asp-Lys-Asp-Ser-Gln-Cys-Gly-Gly-Gly-Met-Cys-Cys-Ala-Val-Ser-Ile-Trp-Val-Lys-Ser-Ile-Arg-Ile-Cys-Thr-Pro-Met-Gly-Lys-Leu-Gly-Asp-Ser-Cys-His-Pro-Leu-Thr-Arg-Lys-Val-Pro-Phe-Phe-Gly-Arg-Arg-Met-His-His-Thr-Cys-Pro-Cys-Leu-Pro-Gly-Leu-Ala-Cys-Leu-Arg-Thr-Ser-Phe-Asn-Arg-Phe-Ile-Cys-Leu-Ala-Gln-Lys-OH trifluoroacetate salt(Disulfide bonds, air oxidized)
One Letter Code: AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK
Synonyms: Bv8
Molecular Formula: C₃₇₉H₆₀₆N₁₁₄O₁₀₁S₁₃
Relative Molecular Mass: 8792.55
CAS#: 423206-00-2
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Details: Prokineticin 2 (Bv8) is one of the first neuropeptides that appears to directly convey circadian rhythm signaling to other CNS structures and, therefore, it may be a critical output molecule regulating biological rhythms. The peptide has the capacity to strongly suppress nocturnal locomotor activity. Prokineticin 2 transmits the behavioural circadian rhythm of the suprachiasmatic nucleus. The peptide binds to the G-protein-coupled receptor PKR2. Gardiner et al. showed that prokineticin 2 potently inhibits food intake.