Service hotline：+86-(0)-18115476705
Product details
Cat#：189P03
Three Letter Code: H-Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg-Arg-Glu-Val-Cys-Glu-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val-OH trifluoroacetate salt(Disulfide bond)
One Letter Code: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Synonyms: Osteocalcin (1-49) (human) (decarboxylated)
Molecular Formula: C₂₆₆H₃₈₁N₆₇O₇₆S₂
Relative Molecular Mass: 5797.49
CAS#: 1927927-11-4
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Diabetes|
Obesity Research
Details: The peptide hormone osteocalcin is involved not only in
bone formation, it also plays an important role in glucose
metabolism and could regulate testosteron. In mice, only
the completely decarboxylated form of the peptide
shows the latter hormonal activities, whereas in humans,
osteocalcin, partially decarboxylated osteocalcins, and
the uncarboxylated peptide seem to be involved.
Generally, obese individuals have been shown to have
lower osteocalcin(s) levels than non-obese controls,
and type 2 diabetic individuals have lower plasma
osteocalcin than non-diabetic individuals.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
