Service hotline:+86-(0)-18115476705
Product details
Cat#:192P02
Three Letter Code: H-Cys-Asp-Ala-Thr-Cys-Gln-Phe-Arg-Lys-Ala-Ile-Asp-Asp-Cys-Gln-Lys-Gln-Ala-His-His-Ser-Asn-Val-Pro-Gly-Asn-Ser-Val-Phe-Lys-Glu-Cys-Met-Lys-Gln-Lys-Lys-Glu-Phe-Lys-Ala-NH₂ trifluoroacetate salt(Disulfide bonds between Cys¹ and Cys⁵/Cys¹⁴ and Cys³²)
One Letter Code: CDATCQFRKAIDDCQKQAHHSNVPGNSVFKECMKQKKEFKA-NH₂
Synonyms: (Des-Lys³⁸)-PAC1 Receptor Antagonist M65
Molecular Formula: C₁₉₉H₃₁₄N₆₂O₆₀S₅
Relative Molecular Mass: 4695.39
CAS#: 1816939-38-4
Source: Synthetic
Storage Conditions: -20 ± 5 °C
1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.