Service hotline：+86-(0)-18115476705
Product details
Cat#：192P06
Three Letter Code: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂ trifluoroacetate salt
One Letter Code: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide-38 (human, mouse, ovine, porcine, rat), PACAP (1-38), human, ovine, rat
Molecular Formula: C₂₀₃H₃₃₁N₆₃O₅₃S
Relative Molecular Mass: 4534.32
CAS#: 124123-15-5
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Alzheimer´s Disease
Details: Kojro et al. observed that the PAC1 agonists PACAP-27 and PACAP-38 strongly increased the activity of α-secretase. Upregulation of this APP-degrading enzyme promotes the non-amyloidogenic processing of APP, i.e. reduces the production of Aβ40/42, and thus may help to prevent Alzheimer’s disease. Nasally applied PACAP-38 in APP[V717I]-transgenic mice additionally enhanced the production of the Aβ-degrading enzyme neprilysin via induction of somatostatin.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
