Service hotline:+86-(0)-18115476705

Product details
Cat#:192P08
Three Letter Code: H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂ trifluoroacetate salt
One Letter Code: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂
Synonyms: Pituitary Adenylate Cyclase Activating Polypeptide-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)
Molecular Formula: C₁₈₂H₃₀₀N₅₆O₄₅S
Relative Molecular Mass: 4024.8
CAS#: 143748-18-9
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Cancer Research
Details: The PACAP selective antagonist PACAP (6-38) is a potent and selective inhibitor of PACAP-27-stimulated pituitary adenylate cyclase with a Ki values of 150 nM.

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.