Welcome to TGpeptide-Professional peptide manufacturer.

Service hotline:+86-(0)-18115476705

199P47

(Ile⁵,Trp²³,Tyr³⁶)-pTH-Related Protein (1-36) (human, mouse, rat) trifluoroacetate salt

H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Trp-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr-OH trifluoroacetate salt

Purity: >95%HPLC
Storage Conditions: -20 ± 5 °C

We can provide this product with other purity from crude to 98%, please contact us for more information.
For reserach use only and not for human use!


Product details

Cat#:199P47
Three Letter Code: H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Trp-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr-OH trifluoroacetate salt
One Letter Code: AVSEIQLLHDKGKSIQDLRRRFWLHHLIAEIHTAEY
Synonyms: (Ile⁵,Trp²³,Tyr³⁶)-pTHrP (1-36) (human, mouse, rat), (Ile⁵,Trp²³,Tyr³⁶)-Hypercalcemia of Malignancy Factor (1-36) (human, mouse, rat)
Molecular Formula: C₁₉₆H₃₀₈N₅₈O₅₃
Relative Molecular Mass: 4324.96
CAS#: 181057-31-8
Source: Synthetic
Storage Conditions: -20 ± 5 °C


How to place a order:

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.

Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.