Service hotline：+86-(0)-18115476705
Product details
Cat#：199P48
Three Letter Code: H-Ala-Val-Ser-Glu-His-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Phe-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr-OH
One Letter Code: AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEY
Synonyms: (Tyr³⁶)-Hypercalcemia of Malignancy Factor (1-36) (human, mouse, rat)
Molecular Formula: C₁₉₄H₃₀₃N₅₉O₅₃
Relative Molecular Mass: 4309.91
CAS#: 213779-11-4
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Osteoporosis Research
Details: (Tyr³⁶)-pTHrP (1-36) has been used for radioiodination.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
