Service hotline:+86-(0)-18115476705
/pTH and pTH-Related Protein (pTHrP) (56)
/pTH-Related Protein Splice Isoform 3 (140-173) (human) trifluoroacetate salt
Product details
Cat#:199P55
Three Letter Code: H-Thr-Ala-Leu-Leu-Trp-Gly-Leu-Lys-Lys-Lys-Lys-Glu-Asn-Asn-Arg-Arg-Thr-His-His-Met-Gln-Leu-Met-Ile-Ser-Leu-Phe-Lys-Ser-Pro-Leu-Leu-Leu-Leu-OH trifluoroacetate salt
One Letter Code: TALLWGLKKKKENNRRTHHMQLMISLFKSPLLLL
Synonyms: pTH-rP Splice Isoform 3 (140-173) (human), Hypercalcemia of Malignancy Factor Splice Isoform 3 (140-173) (human)
Molecular Formula: C₁₈₆H₃₁₃N₅₃O₄₄S₂
Relative Molecular Mass: 4059.99
CAS#: 139872-85-8
Source: Synthetic
Storage Conditions: -20 ± 5 °C
1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.