Service hotline：+86-(0)-18115476705
Product details
Cat#：208P35
Three Letter Code: H-Val-Gln-Ile-Val-Tyr-Lys-Pro-Val-Asp-Leu-Ser-Lys-Val-Thr-Ser-Lys-Cys-Gly-Ser-Leu-Gly-Asn-Ile-His-His-Lys-Pro-Gly-Gly-Gly-Gln-OH trifluoroacetate salt
One Letter Code: VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
Molecular Formula: C₁₄₃H₂₃₆N₄₂O₄₂S
Relative Molecular Mass: 3247.77
CAS#: 330456-26-3
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Tau Peptides
Details: The amphipathic helical structure of the third fragment (306-336) in the four-repeat microtubule-binding domain of the water-soluble tau protein could be responsible for the formation of the neuropathological filament.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
