Service hotline：+86-(0)-18115476705
Product details
Cat#：211P26
Three Letter Code: H-Arg-Ser-Cys-Ile-Asp-Thr-Ile-Pro-Lys-Ser-Arg-Cys-Thr-Ala-Phe-Gln-Cys-Lys-His-Ser-Met-Lys-Tyr-Arg-Leu-Ser-Phe-Cys-Arg-Lys-Thr-Cys-Gly-Thr-Cys-OH trifluoroacetate salt(Disulfide bonds between Cys³ and Cys³⁵/Cys¹² and Cys²⁸/Cys¹⁷ and Cys³²)
One Letter Code: RSCIDTIPKSRCTAFQCKHSMKYRLSFCRKTCGTC
Synonyms: ShK
Molecular Formula: C₁₆₉H₂₇₄N₅₄O₄₈S₇
Relative Molecular Mass: 4054.83
CAS#: 172450-46-3
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Ion Channel Modulating Agents
Details: ShK-toxin, originally isolated from the sea anemone Stichodactyla helianthus, has been found to inhibit the specific binding of dendrotoxin I to rat brain membranes. Due to its unique structure (it contains three intramolecular disulfide bridges) and high affinity for some potassium channels, ShK-toxin may become a useful molecular probe for investigating potassium channels.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
