Service hotline：+86-(0)-18115476705
/VIP, Prepro VIP, Analogs and Fragments (22)
/(Lys¹⁵,Arg¹⁶,Leu²⁷)-VIP (1-7)-GRF (8-27) trifluoroacetate salt
Product details
Cat#：215P15
Three Letter Code: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Lys-Arg-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-NH₂ trifluoroacetate salt
One Letter Code: HSDAVFTNSYRKVLKRLSARKLLQDIL-NH₂
Molecular Formula: C₁₄₂H₂₄₀N₄₄O₃₈
Relative Molecular Mass: 3171.74
CAS#: 201995-58-6
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Details: (Lys¹⁵,Arg¹⁶,Leu²⁷)-VIP (1-7)-GRF (8-27) is a high affinity selective agonist for the human and rat VPAC1 receptors. The compound exhibited negligible affinity for the PACAP and secretin receptors.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
