Welcome to TGpeptide-Professional peptide manufacturer.

Service hotline:+86-(0)-18115476705

215P21

VIP Antagonist

H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂

Purity: >95%HPLC
Storage Conditions: -20 ± 5 °C

We can provide this product with other purity from crude to 98%, please contact us for more information.
For reserach use only and not for human use!


Product details

Cat#:215P21
Three Letter Code: H-Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂
One Letter Code: KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH₂
Synonyms: [Lys1, Pro2,5, Arg3,4, Tyr6] VIP, human, porcine, rat, ovine
Molecular Formula: C₁₅₄H₂₅₇N₄₉O₄₀S
Relative Molecular Mass: 3467.11
CAS#: 125093-93-8
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Cancer Research
Details: VIP antagonist, a hybrid of neurotensin (6-11) and VIP (7-28), is a competitive antagonist of VIP-binding to glial cells. In rats with reduced masculine potential, The peptide markedly inhibits VIP-stimulated sexual behaviour. Furthermore, it has been shown to antagonize VIP receptors on non-small cell lung cancer cells, thereby inhibiting tumor growth in vitro and in vivo.


How to place a order:

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.

Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.