Service hotline：+86-(0)-18115476705
Product details
Cat#: 109P03
Three Letter Code: H-Asp-Asp-Ala-Val-Tyr-Leu-Asp-Asn-Glu-Lys-Glu-Arg-Glu-Glu-Tyr-Val-Leu-Asn-Asp-Ile-Gly-Val-Ile-Phe-Tyr-Gly-Glu-Val-Asn-Asp-Ile-Lys-Thr-Arg-Ser-Trp-Ser-Tyr-Gly-Gln-Phe-OH
One Letter Code: DDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQF
Molecular Formula: C₂₂₀H₃₂₂N₅₄O₇₃
Relative Molecular Mass: 4891.3
CAS#: 158455-48-2
Source: Synthetic
Storage Conditions: -20 ± 5 °C, avoid light, cool and dry place
Areas of Interest: Hematology
Details: This fragment of the coagulation factor XIIIa inhibits cross-linking by the factor XIIIa (IC₅₀ = 52 µM), as well as fibrinogen α-chain cross-linking by the guinea pig liver tissue transglutaminase (IC₅₀ = 13 µM).
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
