Welcome to TGpeptide-Professional peptide manufacturer.

Service hotline:+86-(0)-18115476705

120P19

Tyr-α-CGRP (human)

H-Tyr-Ala-Cys-Asp-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH₂(Disulfide bond)

Purity: >95%HPLC
Storage Conditions: -20 ± 5 °C

We can provide this product with other purity from crude to 98%, please contact us for more information.
For reserach use only and not for human use!


Product details

Cat#: 120P19
Three Letter Code: H-Tyr-Ala-Cys-Asp-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Val-Val-Lys-Asn-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH₂(Disulfide bond)
One Letter Code: YACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH₂
Synonyms: Tyr-CGRP I (human), [Tyr0] Calcitonin Gene Related Peptide, human
Molecular Formula: C₁₇₂H₂₇₆N₅₂O₅₁S₂
Relative Molecular Mass: 3952.54
CAS#: 124756-98-5
Source: Synthetic
Storage Conditions: -20 ± 5 °C, avoid light, cool and dry place


How to place a order:

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.

Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.