Service hotline:+86-(0)-18115476705
Product details
Cat#: 122P02
Three Letter Code: H-Val-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu-OH trifluoroacetate salt(Disulfide bonds between Cys⁶⁸ and Cys⁸⁶/Cys⁷⁴ and Cys⁹⁴/Cys⁸⁸ and Cys¹⁰¹)
One Letter Code: VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Molecular Formula: C₂₂₅H₃₆₅N₆₅O₆₅S₇
Relative Molecular Mass: 5245.23
CAS#: 214050-22-3
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Obesity Research
Details: CART peptides, especially CART (55-102) appear to have an important function in the regulation of energy homeostasis. Intracerebroventricular administration of CART (55-102) reduces appetite and stimulates energy expenditure, whereas injection of the peptide into specific hypothalamic nuclei increases food intake.
1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.