Service hotline：+86-(0)-18115476705
Product details
Cat#: 124P26
Three Letter Code: H-Tyr-Thr-Ile-Trp-Met-Pro-Glu-Asn-Pro-Arg-Pro-Gly-Thr-Pro-Cys-Asp-Ile-Phe-Thr-Asn-Ser-Arg-Gly-Lys-Arg-Ala-Ser-Asn-Gly-Gly-Gly-Gly-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-OH trifluoroacetate salt
One Letter Code: YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRR
Synonyms: Rabies Virus Glycoprotein (194-221) Nonaarginine Chimer, Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R)
Molecular Formula: C₂₀₁H₃₃₄N₈₂O₅₅S₂
Relative Molecular Mass: 4843.51
CAS#: 1678417-57-6
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Cell-permeable Peptides
Details: Chimeric rabies virus glycoprotein fragment peptide (RVG-9R peptide) was able to bind and transduce siRNA to neuronal cells in vitro, resulting in efficient gene silencing. Repeated administration of RVG-9R-bound siRNA did not induce inflammatory cytokines nor anti-peptide antibodies.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
