Service hotline：+86-(0)-18115476705
Product details
Cat#: 125P05
Three Letter Code: H-Ser-Pro-Tyr-Ser-Ser-Asp-Thr-Thr-Pro-Cys-Cys-Phe-Ala-Tyr-Ile-Ala-Arg-Pro-Leu-Pro-Arg-Ala-His-Ile-Lys-Glu-Tyr-Phe-Tyr-Thr-Ser-Gly-Lys-Cys-Ser-Asn-Pro-Ala-Val-Val-Phe-Val-Thr-Arg-Lys-Asn-Arg-Gln-Val-Cys-Ala-Asn-Pro-Glu-Lys-Lys-Trp-Val-Arg-Glu-Tyr-Ile-Asn-Ser-Leu-Glu-Met-Ser-OH trifluoroacetate salt(Disulfide bonds between Cys¹⁰ and Cys³⁴/Cys¹¹ and Cys⁵⁰)
One Letter Code: SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Synonyms: Small-Inducible Cytokine A5, CCL5, T Cell-Specific Protein
P228, TCP228
Molecular Formula: C₃₅₀H₅₃₄N₉₆O₁₀₀S₅
Relative Molecular Mass: 7847.01
CAS#: 1927910-48-2
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Cytokines/Chemokines & their Receptors|
Infectious Disease|
Regenerative Medicine|
Virology
Details: Synthetic product. RANTES is a CC-chemokine that can signal
via the CCR1, CCR3, CCR5 and US28 (cytomegalovirus
receptor) receptors. It is chemotactic for T-cells, human
eosinophils and basophils and plays an active role in recruiting
leukocytes into inflammatory sites. RANTES also has the
capability to inhibit certain strains of HIV-1, HIV-2 and simian
immunodeficiency virus (SIV).
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
