Service hotline:+86-(0)-18115476705

Product details
Cat#:134P01
Three Letter Code: H-Cys-His-Ser-Arg-Ser-Ala-Asp-Val-Asp-Ser-Leu-Ser-Glu-Ser-Ser-Pro-Asn-Ser-Ser-Pro-Gly-Pro-Cys-Pro-Glu-Lys-Ala-Pro-Pro-Pro-Gln-Lys-Pro-Ser-His-Glu-Gly-Ser-Tyr-Leu-Leu-Gln-Pro-OH trifluoroacetate salt(Disulfide bond)
One Letter Code: CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
Molecular Formula: C₁₉₀H₂₉₃N₅₅O₆₈S₂
Relative Molecular Mass: 4499.88
CAS#: 1802086-30-1
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Cardiovascular System & Diseases|
Diabetes|
Obesity Research
Details: Adropin is a secreted factor involved in energy homeostasis and lipid metabolism. It is encoded by the energy homeostasis associated gene (Enho) and is expressed in liver and brain. In diet-induced obesity (DIO) mice Adropin (34-76) attenuated hepatosteatosis and insulin reistance independently of adiposity or food intake. Additionally, adropin could be a regulator of endothelial function.

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.