Service hotline:+86-(0)-18115476705

Product details
Cat#:134P03
Three Letter Code: H-Asp-Val-Ser-Thr-Pro-Pro-Thr-Val-Leu-Pro-Asp-Asn-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Gln-Tyr-Asp-Thr-Trp-Lys-Gln-Ser-Thr-Gln-Arg-Leu-OH trifluoroacetate salt
One Letter Code: DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL
Molecular Formula: C₁₈₇H₂₇₅N₄₇O₅₃
Relative Molecular Mass: 4029.53
CAS#: 315197-69-4
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Diabetes|
Obesity Research|
Regenerative Medicine
Details: Preptin is a 34-amino acid peptide hormone, corresponding to Asp⁶⁹-Leu¹⁰² of the proinsulin-like growth factor II E-peptide. It is co-secreted with insulin and amylin from the pancreatic β-cells and is a physiological amplifier of glucose-mediated insulin secretion. It is also anabolic to bone tissue and may contribute to the preservation of bone mass observed in hyperinsulinemic states such as obesity.

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.