Service hotline:+86-(0)-18115476705
Product details
Cat#:134P04
Three Letter Code: H-Asp-Val-Ser-Thr-Ser-Gln-Ala-Val-Leu-Pro-Asp-Asp-Phe-Pro-Arg-Tyr-Pro-Val-Gly-Lys-Phe-Phe-Lys-Phe-Asp-Thr-Trp-Arg-Gln-Ser-Ala-Gly-Arg-Leu-OH trifluoroacetate salt
One Letter Code: DVSTSQAVLPDDFPRYPVGKFFKFDTWRQSAGRL
Molecular Formula: C₁₈₁H₂₆₈N₄₈O₅₁
Relative Molecular Mass: 3932.41
CAS#: 315197-73-0
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Diabetes|
Regenerative Medicine
Details: Preptin is a 34-amino acid peptide hormone, which is co-secreted with insulin from the pancreatic β-cells in response to glucose stimulation. It is osteogenic in vitro and in vivo and may act in concert with the other β-cell hormones insulin and amylin to stimulate bone formation in hyperinsulinemic states such as obesity.
1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.