Service hotline：+86-(0)-18115476705
Product details
Cat#: 103P04
Three Letter Code: H-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH₂ (Disulfide bond)
One Letter Code: SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH₂
Molecular Formula: C₂₀₀H₃₀₈N₅₈O₅₉S₂
Relative Molecular Mass: 4533.13
CAS#: 154765-05-6
Source: Synthetic
Storage Conditions: -20 ± 5 °C, avoid light, cool and dry place
Areas of Interest: Cardiovascular System & Diseases
Inflammation Research
Details: This adrenomedullin fragment possessed vasodilatory activity. It has been suggested to modulate receptor-mediated, but not voltage-dependent, pulmonary vascular contraction by influencing Ca²⁺ influx. Therefore, it has been proposed that hADM (13-52) acts as an endothelium-dependent vasodilator agent in the pulmonary vascular bed of the rat. Furthermore, this compound may act as a modulator of the vascular phases of inflammation.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
