Service hotline：+86-(0)-18115476705
Product details
Cat#: 103P08
Three Letter Code: H-His-Gln-Val-Pro-Gln-His-Arg-Gly-His-Val-Cys-Tyr-Leu-Gly-Val-Cys-Arg-Thr-His-Arg-Leu-Ala-Glu-Ile-Ile-Gln-Trp-Ile-Arg-Ser-Ala-Ser-Thr-Lys-Glu-Pro-Thr-Gly-Lys-Ala-Ser-Arg-Glu-Pro-Gln-Asn-Pro-Tyr-Ser-Tyr-NH₂(Disulfide bond)
One Letter Code: HQVPQHRGHVCYLGVCRTHRLAEIIQWIRSASTKEPTGKASREPQNPYSY-NH₂
Synonyms: AM5 (primate)
Molecular Formula: C₂₅₃H₃₉₄N₈₂O₇₁S₂
Relative Molecular Mass: 5784.55
CAS#: 1816939-48-6
Source: Synthetic
Storage Conditions: -20 ± 5 °C, avoid light, cool and dry place
Areas of Interest: Cardiovascular System & Diseases
Details: Adrenomedullin 5 (AM5) stimulates central and peripheral cardiovascular actions in mammals. The peptide induced dose-dependent decreases in arterial pressure without affecting the heart rate, when injected intravenously. When injected into the cerebral ventricle, ADM5 increased arterial pressure and heart rate.
1）Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com；
2）Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3）Place us a purchaser order, we can send you a sales contract too if you need;
4）Start synthesis, and we will inform you the updates of synthesis in time;
5）Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6）Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.
