Service hotline:+86-(0)-18115476705
/Peptide YY (PYY) and Related Peptides (7)
/Peptide YY (3-36) (canine, mouse, porcine, rat) trifluoroacetate salt

Product details
Cat#:195P05
Three Letter Code: H-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH₂ trifluoroacetate salt
One Letter Code: AKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH₂
Synonyms: PYY (3-36) (canine, mouse, porcine, rat)
Molecular Formula: C₁₇₆H₂₇₂N₅₂O₅₄
Relative Molecular Mass: 3980.41
CAS#: 126339-09-1
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Gastrointestinal Research
Details: Peptide YY (3-36) and peptide YY are both synthesized by the gastrointestinal tract and released into the circulation after a meal. Peptide YY (3-36) is a Y₂ receptor subtype agonist, whereas peptide YY is non-selective for Y₁ and Y₂ receptor subtypes. It has been suggested that Y₁ and Y₂ receptor subtype binding affinities depend on their secondary and tertiary solution state structures.

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.
Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.