Welcome to TGpeptide-Professional peptide manufacturer.

Service hotline:+86-(0)-18115476705

195P06

Peptide YY (3-36) (human) trifluoroacetate salt

H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH₂ trifluoroacetate salt

Purity: >95%HPLC
Storage Conditions: -20 ± 5 °C

We can provide this product with other purity from crude to 98%, please contact us for more information.
For reserach use only and not for human use!


Product details

Cat#:195P06
Three Letter Code: H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH₂ trifluoroacetate salt
One Letter Code: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH₂
Synonyms: PYY (3-36) (human)
Molecular Formula: C₁₈₀H₂₇₉N₅₃O₅₄
Relative Molecular Mass: 4049.52
CAS#: 123583-37-9
Source: Synthetic
Storage Conditions: -20 ± 5 °C
Areas of Interest: Gastrointestinal Research| Obesity Research
Details: PYY (3-36), a Y2 receptor agonist, is released from the body´s gastrointestinal tract in proportion to caloric intake. It has been shown that peripheral injection of PYY (3-36) in rats inhibited food intake and reduced weight gain. In addition, infusion of PYY (3-36) in humans significantly decreased appetite and reduced food intake by 33% over 24h, which suggests that PYY (3-36) has a role in ´longer term´ regulation of food intake. Thus, the PYY (3-36) may represent a lead compound for the development of drugs for the treatment of obesity.


How to place a order:

1)Contact us at: +86-(0)-18115476705 or sales@tgpeptide.com;
2)Provide us peptides information including Sequence, Purity, Quantity and modification(If necessary, we agree to sign confidential agreement with you before you provide these information), we will make you a quotes within 30 minutes;
3)Place us a purchaser order, we can send you a sales contract too if you need;
4)Start synthesis, and we will inform you the updates of synthesis in time;
5)Arrange shippment, HPLC analysis, MS spectrum will be shipped along the peptides too;
6)Refund all pre-payment(if pre-pay us) if we failed to synthesize any of them.
7) After-sale service: Contact us anytime if you have any problem when you use the peptides, and we will reply you as soon as possible.

Copyright © Nanjing TGpeptide Biotechnology Co.,Ltd.